Table 1

Summary of in vitro and in vivo phosphorylated sites on Brca1 as detected by mass spectrometry.

SitesPeptide*Molecular weight(measured/calculated)Number of PO3 groups
In vitro
S13301326HQSESQGVGLSDKELVSDDEER13472444/2444.51
S14231407LQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEK14525074/5074.41
S14661460SSEYPISQNPEGLSADKFEVSADSSTSK14872961/2961.11
S15241521NYPSQEELIKVVDVEEQQLEESGPHDLTETSY15523706/3706.91
S15421531VVDVEEQQLEESGPHDLTETSY15522504/2504.61
1279ASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSK13224772/4772.11,2§
In vivo
S11891189SPSPFTHTHLAQGYR12031698/1698.91
S1457 1453AVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSK14873689/3689.01,2§
S15421531VVDVEEQQLEESGPHDLTETSYLPR15552871/2871.11
S1524, S15421521NYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPR15554073/4073.41,2§
  • * Amino acids in boldfaced type were unambiguously determined to be sites of phosphorylation by LC/MS/MS.

  • Average molecular weights of the dephosphorylated peptide are listed.

  • At least one phosphorylated amino acid within these peptides could not be determined unambiguously by LC/MS/MS.

  • § Peptides with both 1 and 2 mol of phosphate were observed.